missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207339

Invitrogen™ Human TLX (aa 235-328) Control Fragment Recombinant Protein

Product Code. 30207339
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207339

Brand: Invitrogen™ RP103225

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84261 (PA5-84261. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nuclear receptor TLX, a NR2 hepatocyte NF4-like receptor, has been shown to affect anterior brain differentiation, retinal development, and vision. It has been suggested that TLX targets genes for RAR beta2 and Pax2 during retinal development. Homozygous TLX mutant mice are viable at birth but exhibit reduced forebrain development and are more aggressive than wild-type mice. Mice with deleted TLX locus exhibit cerebral hypoplasia, blindness, and extreme aggression (fierce (frc) phenotype). TLX expression has been documented in mouse brain and eye. ESTs have been isolated from normal human brain libraries.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y466
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7101
Name Human TLX (aa 235-328) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias fc30e03; fc39f12; fierce; frc; HTll; Mtl1; Mtll; NR2D1; nr2e1; Nuclear receptor subfamily 2 group E member 1; nuclear receptor subfamily 2, group E, member 1; nuclear receptor TLX; Protein tailless homolog; tailes-related receptor; tailless; tailless homolog; TLL; Tlx; wu:fc30e03; wu:fc39f12; XTLL; zgc:100991
Common Name TLX
Gene Symbol NR2E1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.