Invitrogen™ Human TL1A (aa 155-251) Control Fragment Recombinant Protein

Product Code. 30198697

Brand: Invitrogen™ RP89871

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is abundantly expressed in endothelial cells, but is not expressed in either B or T cells. The expression of this protein is inducible by TNF and IL-1 alpha. This cytokine is a ligand for receptor TNFRSF25 and decoy receptor TNFRSF21/DR6. It can activate NF-kappaB and MAP kinases, and acts as an autocrine factor to induce apoptosis in endothelial cells. This cytokine is also found to inhibit endothelial cell proliferation, and thus may function as an angiogenesis inhibitor. An additional isoform encoded by an alternatively spliced transcript variant has been reported but the sequence of this transcript has not been determined.

Specifications

• Accession Number: O95150
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9966
• Name: Human TL1A (aa 155-251) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bM20K13.3 (tumor necrosis factor (ligand) superfamily, member 15); MGC129934; MGC129935; TL1; TL1A; TNF ligand-related molecule 1; TNF superfamily ligand TL1A; TNFSF15; TNLG1B; tumor necrosis factor (ligand) superfamily member 15; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand 1 B; tumor necrosis factor ligand superfamily member 15; Tumor necrosis factor ligand superfamily member 15, membrane form; Tumor necrosis factor ligand superfamily member 15, secreted form; tumor necrosis factor superfamily member 15; vascular endothelial cell growth inhibitor; vascular endothelial growth inhibitor; vascular endothelial growth inhibitor-192 A; Vegi; VEGI192A
• Common Name: TL1A
• Gene Symbol: TNFSF15
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining