missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TIRAP (aa 79-162) Control Fragment Recombinant Protein

Codice prodotto. 30211616
Click to view available options
Quantity:
100 μL
Dimensione della confezione:
100µL
This item is not returnable. View return policy

Product Code. 30211616

Brand: Invitrogen™ RP97392

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111393 (PA5-111393. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Toll-like receptors (TLRs) are signaling molecules that recognize different microbial products during infection and serve as an important link between the innate and adaptive immune responses. These proteins act through adaptor molecules such as TIRAP and MyD88 to activate various kinases and transcription factors. In TIRAP-deficient mice, TLR signaling in response to TLR2 ligands (using either TLR1 and TLR6 as co-receptors) is totally abolished, suggesting that MyD88 and TIRAP work together and are both required for TLR2 signaling. Furthermore, these mice are also resistant to the toxic effects of LPS and show defects in NF-βB and MAP kinase activation, suggesting that TIRAP is also involed in TLR4 signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P58753
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 114609
Name Human TIRAP (aa 79-162) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA407980; adapter protein wyatt; adaptor protein Wyatt; BACTS1; C130027E04Rik; FLJ42305; HGNC:17192; Mal; myD88 adapter-like protein; MyD88-2; OTTHUMP00000179130; TIR domain containing adaptor protein; TIR domain-containing adapter protein; TIRAP; Tlr4ap; toll/interleukin-1 receptor domain-containing adapter protein; toll-interleukin 1 receptor (TIR) domain containing adaptor protein; toll-interleukin 1 receptor (TIR) domain-containing adaptor protein; Toll-like receptor 4 adaptor protein; Toll-like receptor adaptor protein; Wyatt
Common Name TIRAP
Gene Symbol TIRAP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQML
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.