Invitrogen™ Human TIRAP (aa 79-162) Control Fragment Recombinant Protein

Product Code. 30211616

Brand: Invitrogen™ RP97392

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111393 (PA5-111393. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Toll-like receptors (TLRs) are signaling molecules that recognize different microbial products during infection and serve as an important link between the innate and adaptive immune responses. These proteins act through adaptor molecules such as TIRAP and MyD88 to activate various kinases and transcription factors. In TIRAP-deficient mice, TLR signaling in response to TLR2 ligands (using either TLR1 and TLR6 as co-receptors) is totally abolished, suggesting that MyD88 and TIRAP work together and are both required for TLR2 signaling. Furthermore, these mice are also resistant to the toxic effects of LPS and show defects in NF-βB and MAP kinase activation, suggesting that TIRAP is also involed in TLR4 signaling.

Specifications

• Accession Number: P58753
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114609
• Name: Human TIRAP (aa 79-162) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA407980; adapter protein wyatt; adaptor protein Wyatt; BACTS1; C130027E04Rik; FLJ42305; HGNC:17192; Mal; myD88 adapter-like protein; MyD88-2; OTTHUMP00000179130; TIR domain containing adaptor protein; TIR domain-containing adapter protein; TIRAP; Tlr4ap; toll/interleukin-1 receptor domain-containing adapter protein; toll-interleukin 1 receptor (TIR) domain containing adaptor protein; toll-interleukin 1 receptor (TIR) domain-containing adaptor protein; Toll-like receptor 4 adaptor protein; Toll-like receptor adaptor protein; Wyatt
• Common Name: TIRAP
• Gene Symbol: TIRAP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining