missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TIP60 (aa 417-510) Control Fragment Recombinant Protein

Product Code. 30203929
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203929

Brand: Invitrogen™ RP109873

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145070 (PA5-145070. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIP60 is a transcription factor, originally isolated as an HIV-1 TAT-interactive protein, known to interact with the viral TAT protein that leads to HTATIP polyubiquitination and targets it for degradation. It belongs to the MYST family of histone acetyl transferases (HATs). TIP60 is a catalytic subunit of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. A co-regulator of transcription factors, TIP60 either promotes or suppresses tumorigenesis. TIP60 is an enzyme that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92993
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10524
Name Human TIP60 (aa 417-510) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 60 kDa Tat-interactive protein; AI839539; cPLA(2)-interacting protein; CPLA2; cPLA2 interacting protein; ESA1; histone acetyltransferase HTATIP; Histone acetyltransferase KAT5; HIV-1 Tat interactive protein; HIV-1 tat interactive protein 1, 60 kDa homolog; HIV-1 tat interactive protein 1, homolog; HIV-1 Tat interactive protein 60 kD; HIV-1 Tat interactive protein, 60 kD; HIV-1 Tat interactive protein, 60 kDa; HIV-1 tat interactive protein, homolog; HTATIP; Htatip1; K(lysine) acetyltransferase 5; K-acetyltransferase 5; Kat5; Lysine acetyltransferase 5; PLIP; Tat interacting protein, 60 kDa; Tat-interactive protein-60; TIP; Tip55; Tip60; TIP60(HTATIP); Tip60b; ZC2HC5
Common Name TIP60
Gene Symbol KAT5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.