Invitrogen™ Human TIP60 (aa 150-286) Control Fragment Recombinant Protein

Product Code. 30204722

Brand: Invitrogen™ RP89405

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIP60 is a transcription factor, originally isolated as an HIV-1 TAT-interactive protein, known to interact with the viral TAT protein that leads to HTATIP polyubiquitination and targets it for degradation. It belongs to the MYST family of histone acetyl transferases (HATs). TIP60 is a catalytic subunit of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. A co-regulator of transcription factors, TIP60 either promotes or suppresses tumorigenesis. TIP60 is an enzyme that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.

Specifications

• Accession Number: Q92993
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10524
• Name: Human TIP60 (aa 150-286) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 60 kDa Tat-interactive protein; AI839539; cPLA(2)-interacting protein; CPLA2; cPLA2 interacting protein; ESA1; histone acetyltransferase HTATIP; Histone acetyltransferase KAT5; HIV-1 Tat interactive protein; HIV-1 tat interactive protein 1, 60 kDa homolog; HIV-1 tat interactive protein 1, homolog; HIV-1 Tat interactive protein 60 kD; HIV-1 Tat interactive protein, 60 kD; HIV-1 Tat interactive protein, 60 kDa; HIV-1 tat interactive protein, homolog; HTATIP; Htatip1; K(lysine) acetyltransferase 5; K-acetyltransferase 5; Kat5; Lysine acetyltransferase 5; PLIP; Tat interacting protein, 60 kDa; Tat-interactive protein-60; TIP; Tip55; Tip60; TIP60(HTATIP); Tip60b; ZC2HC5
• Common Name: TIP60
• Gene Symbol: KAT5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining