Invitrogen™ Human TIN2 (aa 266-347) Control Fragment Recombinant Protein

Product Code. 30207770

missing translation for 'mfr': Invitrogen™ RP106912

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111477 (PA5-111477. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRF1 is a negative regulator of telomere length maintenance. Recently two proteins, tankyrase and Tin2, which bind to mammalian TRF1, have been identified. Tankyrase is a protein with homology to ankyrins as well as to the catalytic domain of poly (adenosine diphosphate-ribose) polymerase (PARP). Tankyrase localizes to telomeres by binding to the telomeric repeat binding factor 1 (TRF1) through its ankyrin repeats. Tankyrase exhibits PARP activity functioning as acceptors for adenosine diphosphate (ADP)-ribosylation. Since ADP-ribosylation of TRF1 diminishes its ability to bind to telomeric DNA, this suggests that telomere function in human cells is regulated by poly (ADP)-ribosylation. Both the cell cycle and TRF1 may regulate the subcellular localization of tankyrase. The cDNA coding for TIN2 protein was isolated as interacting partner of TRF1 from a yeast two-hybrid cDNA library screening. Tin2 localizes to telomeres and is essential for proper regulation of telomere length. TIN2, like TRF1, is widely and constitutively expressed, suggesting that these proteins act together to counterbalance telomere elongation by telomerase. However, endogenous TIN2, like endogenousTRF1, is not highly expressed, and therefore may be difficult to visualize by immunostaining in certain cell systems.

Specifications

• Accession Number: Q9BSI4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26277
• Name: Human TIN2 (aa 266-347) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW552114; D14Wsu146e; DKCA3; TERF1 (TRF1)-interacting nuclear factor 2; TERF1 interacting nuclear factor 2; TERF1-interacting nuclear factor 2; tin; TIN2; Tin-2; TINF2; TRF1-interacting nuclear factor 2; TRF1-interacting nuclear protein 2
• Common Name: TIN2
• Gene Symbol: Tinf2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining