missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TIN2 (aa 152-225) Control Fragment Recombinant Protein

Product Code. 30198851
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198851

Brand: Invitrogen™ RP105488

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67076 (PA5-67076. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRF1 is a negative regulator of telomere length maintenance. Recently two proteins, tankyrase and Tin2, which bind to mammalian TRF1, have been identified. Tankyrase is a protein with homology to ankyrins as well as to the catalytic domain of poly (adenosine diphosphate-ribose) polymerase (PARP). Tankyrase localizes to telomeres by binding to the telomeric repeat binding factor 1 (TRF1) through its ankyrin repeats. Tankyrase exhibits PARP activity functioning as acceptors for adenosine diphosphate (ADP)-ribosylation. Since ADP-ribosylation of TRF1 diminishes its ability to bind to telomeric DNA, this suggests that telomere function in human cells is regulated by poly (ADP)-ribosylation. Both the cell cycle and TRF1 may regulate the subcellular localization of tankyrase. The cDNA coding for TIN2 protein was isolated as interacting partner of TRF1 from a yeast two-hybrid cDNA library screening. Tin2 localizes to telomeres and is essential for proper regulation of telomere length. TIN2, like TRF1, is widely and constitutively expressed, suggesting that these proteins act together to counterbalance telomere elongation by telomerase. However, endogenous TIN2, like endogenousTRF1, is not highly expressed, and therefore may be difficult to visualize by immunostaining in certain cell systems.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BSI4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26277
Name Human TIN2 (aa 152-225) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW552114; D14Wsu146e; DKCA3; TERF1 (TRF1)-interacting nuclear factor 2; TERF1 interacting nuclear factor 2; TERF1-interacting nuclear factor 2; tin; TIN2; Tin-2; TINF2; TRF1-interacting nuclear factor 2; TRF1-interacting nuclear protein 2
Common Name TIN2
Gene Symbol Tinf2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.