Invitrogen™ Human TIMM8B (aa 4-82) Control Fragment Recombinant Protein

Product Code. 30211159

Brand: Invitrogen™ RP97380

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59466 (PA5-59466. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma.

Specifications

• Accession Number: Q9Y5J9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26521
• Name: Human TIMM8B (aa 4-82) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ddp2; DDPL; DDP-like protein; Deafness dystonia protein 2; deafness dystonia protein 2 homolog; Mitochondrial import inner membrane translocase subunit Tim8 B; small zinc finger-like protein DDP2; TIM8B; TIMM8B; translocase of inner mitochondrial membrane 8 homolog b; translocase of inner mitochondrial membrane 8 homolog b (yeast); translocase of inner mitochondrial membrane 8 B
• Common Name: TIMM8B
• Gene Symbol: TIMM8B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining