Invitrogen™ Human TIMM50 (aa 167-249) Control Fragment Recombinant Protein

Product Code. 30197275

Brand: Invitrogen™ RP103257

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63305 (PA5-63305. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TIMM50 (Mitochondrial import inner membrane translocase subunit TIM50) is an enzyme that in humans is encoded by the TIMM50 gene. Tim50 is a subunit of the Tim23 translocase complex in the inner mitochondrial membrane. Mutations in TIMM50 can lead to epilepsy, severe intellectual disability, and 3-methylglutaconic aciduria. TIMM50 expression is increased in breast cancer cells and decreased in hypertrophic hearts.

Specifications

• Accession Number: Q3ZCQ8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92609
• Name: Human TIMM50 (aa 167-249) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810403L02Rik; AU015082; homolog of yeast Tim50; hypothetical protein LOC505489; LOC687295; LOW QUALITY PROTEIN: mitochondrial import inner membrane translocase subunit TIM50; MGC102733; mitochondrial import inner membrane translocase subunit TIM50; PRO1512; similar to translocase of inner mitochondrial membrane 50 homolog; TIM50; TIM50L; Tim50-like protein; timm50; timm50 protein; translocase of inner mitochondrial membrane 50; translocase of inner mitochondrial membrane 50 homolog; translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae); translocase of inner mitochondrial membrane 50-like protein; zgc:66357
• Common Name: TIMM50
• Gene Symbol: TIMM50
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining