Invitrogen™ Human TIMM44 (aa 116-218) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30180669	100 μL	100µL

Product Code. 30180669 Supplier Invitrogen™ Supplier No. RP98973

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a peripheral membrane protein associated with the mitochondrial inner membrane translocase, which functions in the import of proteins across the mitochondrial inner membrane and into the mitochondrial matrix. The encoded protein mediates binding of mitochondrial heat shock protein 70 to the translocase of inner mitochondrial membrane 23 (TIM23) complex. Expression of this gene is upregulated in kidney in a mouse model of diabetes. A mutation in this gene is associated with familial oncocytic thyroid carcinoma.

Specifications

• Accession Number: O43615
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10469
• Name: Human TIMM44 (aa 116-218) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0710005E20Rik; D8Ertd118e; Mimt44; Mitochondrial import inner membrane translocase subunit TIM44; Tim44; TIMM44; translocase of inner mitochondrial membrane 44; translocase of inner mitochondrial membrane 44 homolog; translocase of inner mitochondrial membrane 44 homolog (yeast); translocator of inner mitochondrial membrane 44; translocator of inner mitochondrial membrane 44; DNA segment, Chr 8, ERATO Doi 118, expressed
• Common Name: TIMM44
• Gene Symbol: TIMM44
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVLRKKLGELTGTVKESLHEVSKSDLGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining