Invitrogen™ Human TIMM21 (aa 6-107) Control Fragment Recombinant Protein

Product Code. 30204110

Brand: Invitrogen™ RP89986

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52710 (PA5-52710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in mitochondrial cytochrome c oxidase assembly; mitochondrial respiratory chain complex I assembly; and protein import into mitochondrial matrix. Part of TIM23 mitochondrial import inner membrane translocase complex.

Specifications

• Accession Number: Q9BVV7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29090
• Name: Human TIMM21 (aa 6-107) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700034H14Rik; 2700002I20Rik; C18orf55; HSPC154; Mitochondrial import inner membrane translocase subunit Tim21; Tim21; TIM21-like protein, mitochondrial; TIMM21; tranlocase of inner mitochondrial membrane 21; translocase of inner mitochondrial membrane 21; translocase of inner mitochondrial membrane 21 homolog
• Common Name: TIMM21
• Gene Symbol: TIMM21
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGPSPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining