Invitrogen™ Human TIMM17B (aa 121-172) Control Fragment Recombinant Protein

Product Code. 30202477

Brand: Invitrogen™ RP95442

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56054 (PA5-56054. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a multipass transmembrane protein that forms an integral component of the mitochondrial translocase TIM23 complex. This complex facilitates the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. There is a pseudogene for this gene on chromosome 12. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: O60830
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10245
• Name: Human TIMM17B (aa 121-172) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 17 kDa; DXS9822; inner mitochondrial membrane preprotein translocase; JM3; Mitochondrial import inner membrane translocase subunit Tim17-B; mTim17b; RGD1561744; Sfc3; TIM17B; TIMM17B; translocase of inner mitochondrial membrane 17 homolog B (yeast); translocase of inner mitochondrial membrane 17 b; translocator of inner mitochondrial membrane 17 kDa, b; translocator of inner mitochondrial membrane 17 b; translocator of inner mitochondrial membrane b
• Common Name: TIMM17B
• Gene Symbol: Timm17b
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining