Invitrogen™ Human TIMELESS Control Fragment Recombinant Protein

Product Code. 30200100

Brand: Invitrogen™ RP94979

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63886 (PA5-63886. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The general transcription factor IIE (TFIIE) is part of the RNA polymerase II transcription initiation complex, recruiting TFIIH and being essential for promoter clearance by RNA polymerase II. TFIIE is a heterodimer (and sometimes heterotetramer) of alpha and beta subunits. The protein encoded by this gene represents the beta subunit of TFIIE.

Specifications

• Accession Number: Q9UNS1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8914
• Name: Human TIMELESS Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C77407; Debt69; hTIM; mTim; Protein timeless homolog; RGD:620939}; rTIM; rTLP; TIM; Tim1; timeless; timeless {ECO:0000312; timeless circadian clock; timeless circadian clock 1; timeless circadian regulator; timeless homolog; TIMELESS1; timeless-like protein; Tof1 homolog; unknown
• Common Name: TIMELESS
• Gene Symbol: TIMELESS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FVELLFWKNTAVVREMTEGYGSLDDRSSSRRAPTWSPEEEAHLQELYLANKDVEGQDVVEAILAHLNTVPRTRKQIIHHLVQMGLADSVKDFQR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining