missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TIGAR (aa 2-94) Control Fragment Recombinant Protein

Product Code. 30203211
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203211

Brand: Invitrogen™ RP102956

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the kelch family of proteins, which are characterized by kelch repeat motifs and a POZ/BTB protein-binding domain. It is thought that kelch repeats are actin binding domains. However, the specific function of this protein has not been determined. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQ88
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57103
Name Human TIGAR (aa 2-94) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9630033F20Rik; AA793651; AI595337; C12orf5; C27H12orf5; C79710; C85509; FR2BP; Fructose-2,6-bisphosphatase TIGAR; fructose-2,6-bisphosphate 2-phosphatase; hypothetical protein LOC502894; LOC502894; probable fructose-2,6-bisphosphatase TIGAR; TIGAR; TP53 induced glycolysis regulatory phosphatase; TP53-induced glycolysis and apoptosis regulator; TP53-induced glycolysis regulatory phosphatase; transactivated by NS3TP2 protein; Trp53 induced glycolysis repulatory phosphatase
Common Name TIGAR
Gene Symbol TIGAR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKFCKDMTVKYDSRLRERKYGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.