Invitrogen™ Human Thyroid Peroxidase (aa 684-804) Control Fragment Recombinant Protein

Product Code. 30205652

Brand: Invitrogen™ RP90132

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82323 (PA5-82323. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Thyroid Peroxidase is a gene that encodes for a membrane-bound glycoprotein, which functions as an enzyme and plays a crucial role in the proper functioning of the thyroid gland. This protein is responsible for the iodination of tyrosine residues in thyroglobulin and the formation of phenoxy-ester between pairs of iodinated tyrosines, which leads to the production of thyroid hormones such as thyroxine and triiodothyronine. Mutations in this gene are known to cause several disorders related to thyroid hormone production, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Several transcript variants encoding distinct isoforms have been identified for this gene, but the full-length nature of some variants remains undetermined. Diseases associated with TPO include Thyroid Dyshormonogenesis 2A and Congenital Hypothyroidism.

Specifications

• Accession Number: P07202
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7173
• Name: Human Thyroid Peroxidase (aa 684-804) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EC 1.11.1; LOW QUALITY PROTEIN: thyroid peroxidase; MSA; TDH2A; thyroid microsomal antigen; thyroid peroxidase; thyroid peroxidase (332 AA); thyroperoxidase; TPO; TPX; TPXEC 1.11.1.8
• Common Name: Thyroid Peroxidase
• Gene Symbol: TPO
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining