missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204410

Invitrogen™ Human Thymidine Phosphorylase (aa 21-145) Control Fragment Recombinant Protein

Product Code. 30204410
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204410

Brand: Invitrogen™ RP91382

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-81876 (PA5-81876, PA5-81917 (PA5-81917. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A platelet-derived endothelial growth factor (PD-ECGF), same as thymidine phosphorylase (TP) or gliostatin. In the presence of inorganic orthophosphate, it catalyses the reversible phospholytic cleavage of thymidine and deoxyuridine to their corresponding bases and 2-deoxyribose-1-phosphate. It is both chemotactic and mitogenic for endothelial cells and a non-heparin binding angiogenic factor present in platelets. It is also involved in transformation of fluoropyrimidines, cytotoxic agents used in the treatment of a variety of malignancies, into active cytotoxic metabolites.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19971
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1890
Name Human Thymidine Phosphorylase (aa 21-145) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900072D10Rik; ECGF; Ecgf1; endothelial cell growth factor 1 (platelet-derived); gliostatin; hPD-ECGF; MEDPS1; MNGIE; MTDPS1; OTTHUMP00000196767; OTTHUMP00000196770; PD TP; PDECGF; PD-ECGF; Pdgfec; platelet derived growth factor, endothelial cell; Platelet-derived endothelial cell growth factor; TdRPase; thymidine phosphorylase; TP; TYMP
Common Name Thymidine Phosphorylase
Gene Symbol TYMP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.