missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198951

Invitrogen™ Human ThPOK (aa 228-355) Control Fragment Recombinant Protein

Product Code. 30198951
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198951

Brand: Invitrogen™ RP89376

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52351 (PA5-52351. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1; MIM 120150) and has a role in development.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15156
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51043
Name Human ThPOK (aa 228-355) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CKROX; c-KROX; DKFZp686G01254; hcKROX; Krueppel-related zinc finger protein cKrox; RP11-307C12.9; T helper-inducing POZ/Krueppel factor; T-helper-inducing POZ/Krueppel-like factor; Thpok; Vzinc finger and BTB domain containing 7 B; ZBTB15; ZBTB7B; ZFP67; Zfp-67; zinc finger and BTB domain containing 15; zinc finger and BTB domain containing 7 B; Zinc finger and BTB domain-containing protein 15; Zinc finger and BTB domain-containing protein 7 B; zinc finger protein 67; Zinc finger protein 67 homolog; zinc finger protein 857 B; Zinc finger protein Th-POK; ZNF857B
Common Name ThPOK
Gene Symbol Zbtb7b
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.