Invitrogen™ Human THOC5 (aa 314-449) Control Fragment Recombinant Protein

Product Code. 30201856

Brand: Invitrogen™ RP104854

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65514 (PA5-65514. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between THOC4 and the cap-binding protein NCBP1. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction beteen KSHV ORF57 protein and THOC4. UAP56 functions as a bridge between THOC4 and the THO complex. THOC5 in conjunction with THOC4 functions in NXF1-NXT1 mediated nuclear export of HSP70 mRNA. May be involved in the differentiation of granulocytes and adipocytes.

Specifications

• Accession Number: Q13769
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8563
• Name: Human THOC5 (aa 314-449) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700060C24Rik; A430085L24Rik; C22orf19; Fmip; Fms interacting protein; Fms-interacting protein; fSAP79; Functional spliceosome-associated protein 79; hTRE x 90; KIAA0983; NF2/meningioma region protein pK1.3; PK1.3; placental protein 39.2; PP39.2; serum/glucocorticoid regulated kinase 2; Sgk2; THO complex 5; THO complex subunit 5 homolog; Thoc5
• Common Name: THOC5
• Gene Symbol: THOC5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVMLDLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVGILTLSDYVLELGHPYLWVQKLGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining