Invitrogen™ Human THOC3 (aa 171-248) Control Fragment Recombinant Protein

Product Code. 30181481

Brand: Invitrogen™ RP99037

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111161 (PA5-111161. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THOC3 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.TEX1 is part of the TREX (transcription/export) complex, which includes THO2, HPR1, ALY, and UAP56.

Specifications

• Accession Number: Q96J01
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84321
• Name: Human THOC3 (aa 171-248) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410044K02Rik; AL033344; hTREX45; LOC529231 protein; TEX1; TEX1 homolog; THO complex 3; THO complex subunit 3; Tho3; Thoc3; zgc:100815
• Common Name: THOC3
• Gene Symbol: THOC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining