missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human THNSL2 (aa 268-356) Control Fragment Recombinant Protein

Product Code. 30205854
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205854

Brand: Invitrogen™ RP96115

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57258 (PA5-57258. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THNSL2 (threonine synthase-like 2), also known as TSH2, is a 484 amino acid protein belonging to the threonine synthase family. Utilizing pyridoxal phosphate as a cofactor, THNSL2 may function as a catabolic phospholyase on gamma and beta phosphorylated substrates. THNSL2 may also degrade O-phospho-threonine to alpha-ketobutyrate, ammonia and phosphate. Existing as four alternatively spliced isoforms, THNSL2 is encoded by a gene mapping to human chromosome 2p11.2. As the second largest human chromosome, chromosome 2 makes up approximately 8% of the human genome and contains 237 million bases encoding over 1,400 genes. A number of genetic diseases are linked to genes on chromosome 2. Harlequin icthyosis, a rare skin deformity, is associated with mutations in the ABCA12 gene. The lipid metabolic disorder sitosterolemia is associated with ABCG5 and ABCG8 gene defects. An extremely rare recessive genetic disorder, Alstrom syndrome, is related to mutations in the ALMS1 gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86YJ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55258
Name Human THNSL2 (aa 268-356) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC051244; FLJ10916; FLJ35504; RGD1309144; secreted osteoclastogenic factor of activated T cells; Secreted osteoclastogenic factor of activated T-cells; SOFAT; THNSL2; threonine synthase like 2; threonine synthase-like 2; threonine synthase-like 2 (bacterial); threonine synthase-like 2 (S. cerevisiae); THS2; TSH2
Common Name THNSL2
Gene Symbol THNSL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.