Invitrogen™ Human Thioredoxin 2 (aa 27-164) Control Fragment Recombinant Protein

Product Code. 30195408

Brand: Invitrogen™ RP91356

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81912 (PA5-81912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Thioredoxins (Trx) are small, multi-functional proteins with oxidoreductase activity and are ubiquitous in essentially all living cells. Trx contains a redox-active disulfide/dithiol group within the conserved Cys-Gly-Pro-Cys active site. The two cystein residues in the conserved active centers can be oxidized to form intramolecular disulfide bonds. Reduction of the active site disulfide in oxidized Trx is catalyzed by Trx reductase with NADPH as the electron donor. The reduced Trx is a hydrogen donor for ribonucleotide reductase, the essential enzyme for DNA synthesis, and a potent general protein disulfide reductase with numerous functions in growth and redox regulations. Specific protein disulfide targets for reduction by Trx include protein disulfide-isomerase (PDI) and a number of transcription factors such as p53, NF-kB and AP-1 (T1-151). Trx is also capable of removing H2O2, particularly when it is coupled with either methionine sulfoxide reductase or several isoforms of peroxiredoxins.

Specifications

• Accession Number: Q99757
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25828
• Name: Human Thioredoxin 2 (aa 27-164) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510006J11Rik; AI788873; COXPD29; G7746; hypothetical protein LOC402938; LMA1; mitochondrial thioredoxin; MTRX; mt-Trx; thioredoxin 2; Thioredoxin II; thioredoxin nuclear gene encoding mitochondrial protein; thioredoxin TRX2; thioredoxin, mitochondrial; Thioredoxin-1; Thioredoxin2; Thioredoxin-2; TR-II; TRX1; Trx2; TRX-2; Txn2; YGR209C; zgc:77127
• Common Name: Thioredoxin 2
• Gene Symbol: TXN2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LTSRALQTPQCSPGGLTVTPNPARTIYTTRISLTTFNIQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLEAFLKKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining