missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211834

Invitrogen™ Human Themis (aa 68-163) Control Fragment Recombinant Protein

Product Code. 30211834
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211834 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211834 Supplier Invitrogen™ Supplier No. RP94952

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56740 (PA5-56740. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Themis is a cytoplasmic protein that is essential for positive selection and the development of single-positive thymocytes. Highest levels of expression are found in CD4+CD8+ double-positive thymocytes, with lower expression found in mature T cells. In addition to Grb1, Themis has been found to associate with PLC gamma 1 and LAT and is quickly phosphorylated by SLP-76 following TCR signaling. There are 5 isoforms of mouse Themis that are produced as a result of alternative splicing.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8N1K5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 387357
Name Human Themis (aa 68-163) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bA325O24.3; bA325O24.4; C6orf190; C6orf207; E430004N04Rik; FLJ40584; Gasp; GRB2-associated protein; Grb2-associating protein; MGC163388; Protein THEMIS; Protein thylex; RGD1560849; signaling phosphoprotein specific for T cells; SPOT; THEMIS; thylex; thymocyte expressed molecule involved in selection; thymocyte selection associated; thymocyte selection pathway associated; thymocyte-expressed molecule involved in selection; Tsepa
Common Name Themis
Gene Symbol Themis
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.