missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203510

Invitrogen™ Human THAP12 (aa 360-447) Control Fragment Recombinant Protein

Product Code. 30203510
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203510

Brand: Invitrogen™ RP110117

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145152 (PA5-145152. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of DNAJC3, resulting in restoration of kinase activity and suppression of cell growth.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43422
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5612
Name Human THAP12 (aa 360-447) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900052B10Rik; 52 kDa repressor of the inhibitor of the protein kinase; 58 kDa interferon-induced protein kinase-interacting protein; DAP4; death-associated protein 4; inhibitor of protein kinase PKR; interferon-inducible, double stranded RNA dependent inhibitor, protein-kinase; P52rIPK; p58IPK-interacting protein; P58IPK-regulatory protein; PRKRIR; protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor); Rpkrir; testicular tissue protein Li 133; THAP domain containing 12; THAP domain-containing protein 0; THAP domain-containing protein 12; THAP0; THAP12
Common Name THAP12
Gene Symbol THAP12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELKEICHSQWTGRHDAFEILVELLQALVLC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.