Invitrogen™ Human THADA (aa 1066-1159) Control Fragment Recombinant Protein

Product Code. 30203494

Brand: Invitrogen™ RP102654

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57193 (PA5-57193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

THADA (thyroid adenoma associated), also known as GITA, is a 1,953 amino acid protein that is expressed in testis, thyroid, pancreas, stomach and small intestine. Chromosomal aberrations in the gene encoding THADA are associated with benign thyroid adenomas, suggesting a potential role for THADA in tumorigenesis. The THADA gene maps to human chromosome 2, which houses over 1,400 genes and comprises nearly 8% of the human genome. Harlequin icthyosis, a rare and morbid skin deformity, is associated with mutations in the chromosome 2-localized ABCA12 gene, while the lipid metabolic disorder sitosterolemia is associated with defects in the ABCG5 and ABCG8 genes, which also map to chromosome 2.

Specifications

• Accession Number: Q6YHU6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 63892
• Name: Human THADA (aa 1066-1159) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6530405K19; A930021O22; ARMC13; AU019899; BC052885; death receptor-interacting protein; gene inducing thyroid adenomas protein; GITA; KIAA1767; putative death receptor-interacting protein; RGD1560519; Thada; THADA armadillo repeat containing; THADA, armadillo repeat containing; thyroid adenoma associated; thyroid adenoma-associated protein; Thyroid adenoma-associated protein homolog
• Common Name: THADA
• Gene Symbol: THADA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MLCQLLPMQPVPESSDGLLTVEQVKEIGDYFKQHLLQSRHRGAFELAYTGFVKLTEVLNRCPNVSLQKLPEQWLWSVLEEIKCSDPSSKLCATR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining