Invitrogen™ Human TGM3 (aa 445-570) Control Fragment Recombinant Protein

Product Code. 30196653

Brand: Invitrogen™ RP102406

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82161 (PA5-82161. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. The protein encoded by this gene consists of two polypeptide chains activated from a single precursor protein by proteolysis. The encoded protein is involved the later stages of cell envelope formation in the epidermis and hair follicle.

Specifications

• Accession Number: Q08188
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7053
• Name: Human TGM3 (aa 445-570) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI893889; E polypeptide; E polypeptide, protein-glutamine-gamma-glutamyltransferase; MGC126249; MGC126250; protein-glutamine gamma-glutamyltransferase E; Protein-glutamine gamma-glutamyltransferase E 27 kDa non-catalytic chain; Protein-glutamine gamma-glutamyltransferase E 50 kDa catalytic chain; protein-glutamine-gamma-glutamyltransferase; RGD1561831; TG E; TG(E); TGase E; TGase TGase-3; Tgase3; TGase-3; TGE; TGM3; transglutaminase 3; transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase); transglutaminase 3, E polypeptide; transglutaminase E; Transglutaminase-3
• Common Name: TGM3
• Gene Symbol: TGM3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSDQERQVFQKALGKLKPNTPFAATSSMGLETEEQEPSIIGKLKVAGMLAVGKEVNLVLLLKNLSRDTKTVTVNMTAWTIIYNGTLVHEVWKDSATMSLDPEEEAEHPIKISYAQYEKYLKSDNMI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining