Invitrogen™ Human TGM2 (aa 568-656) Control Fragment Recombinant Protein

Product Code. 30203163

Brand: Invitrogen™ RP92583

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110980 (PA5-110980. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transglutaminase (TGase) catalyses the crosslink of proteins by forming e-(g-glutamyl) lysine isopeptide bonds and requires the binding of Ca2+ for its activity. In mammals, eight distinct TGase isoenzymes have been identified. Tissue transglutaminase (tTGase), also known as TGase 2, has four distinct domains: N-terminal b-sandwich, catalytic core and two C-terminal b-barrel domains. tTGase may have a role in cell death, cell proliferation, cell differentiation, and receptor-mediated endocytosis. In the Alzheimer's disease brain, the elevated tTGase activity is manifested by polymerization of a number of proteins, including Ab peptide, b-amyloid precursor protein and the tau protein, with formation of neurofibrillary tangles.

Specifications

• Accession Number: P21980
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7052
• Name: Human TGM2 (aa 568-656) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C polypeptide; C polypeptide, protein-glutamine-gamma-glutamyltransferase; G alpha h; G[a]h; G-ALPHA-h; GNAH; Protein-glutamine gamma-glutamyltransferase 2; protein-glutamine-gamma-glutamyltransferase; RP5-1054A22.2; TG C; TG(C); TG2; TGase C; TGase H; TGase2; TGase-2; TGase-H; TgaseII; TGC; TGM2; Tissue transglutaminase; Tissue type transglutaminase; tissue-type transglutaminase; transglutaminase; transglutaminase 2; transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase); Transglutaminase 2 C polypeptide; transglutaminase 2, C polypeptide; transglutaminase C; Transglutaminase H; transglutaminase-2; tTG; tTGas
• Common Name: TGM2
• Gene Symbol: TGM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEPVINSYLLAERDLYLENPEIKIRILGEPKQKRKLVAEVSLQNPLPVALEGCTFTVEGAGLTEEQKTVEIPDPVEAGEEVKVRMDLLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining