Learn More
Abnova™ Human TGFB1 (P01137) Partial Recombinant Protein expressed in CHO cells
Description
TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM]
Specifications
Specifications
| Accession Number | P01137 |
| For Use With (Application) | Functional Study, SDS-PAGE |
| Formulation | Lyophilized |
| Gene ID (Entrez) | 7040 |
| Molecular Weight (g/mol) | 25.0kDa |
| Name | TGFB1 (Human) Recombinant Protein |
| Preparation Method | Mammalian cell (CHO) expression system |
| Quantity | 10 μg |
| Immunogen | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Storage Requirements | Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended. |
| Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.