Abnova™ Human TGFB1 (P01137) Partial Recombinant Protein expressed in CHO cells

Product Code. 16292460

Brand: Abnova™ P6032.10ug

Description

Used for Func, SDS-PAGE

TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM]

Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Specifications

• Accession Number: P01137
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 7040
• Molecular Weight (g/mol): 25.0kDa
• Name: TGFB1 (Human) Recombinant Protein
• Preparation Method: Mammalian cell (CHO) expression system
• Quantity: 10 μg
• Immunogen: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Storage Requirements: Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, to further dilute in buffer containing carrier protein (e.g. 0.1% BSA) and store in aliquots at -20°C to -80°C is recommended.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (<1 EU/μg)
• Gene Alias: CED/DPD1/TGFB/TGFbeta
• Common Name: TGFB1
• Gene Symbol: TGFB1
• Assays: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Biological Activity: Determined by TGFB1's ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells. The expected ED₅₀ is ≤ 0.05ng/mL, corresponding to a specific activity of >= 2 x 10⁷ units/mg.
• Cross Reactivity: Bovine,Chicken,Dog,Frog,Monkey,Mouse,Pig,Rabbit,Rat ;Bovine,Chicken,Dog,Frog,Monkey,Mouse,Pig,Rabbit,Rat
• Species: Human
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Mammalian cell (CHO) expression system
• Form: Lyophilized
• Purity or Quality Grade: 0.98