Invitrogen™ Human TGF beta-1 (aa 194-277) Control Fragment Recombinant Protein

Product Code. 30206563

Brand: Invitrogen™ RP109343

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TGF beta-1 (TGFB1, Transforming Growth Factor Beta 1) is a polypeptide member of the transforming growth factor beta superfamily of cytokines, found almost ubiquitously in tissues. Transforming growth factor (TGF)-b is stored in the extracellular matrix as a latent complex with its pro-domain. Activation of TGF beta-1 requires the binding of aV integrin to an RGD sequence in the prodomain and exertion of force on this domain, which is held in the extracellular matrix by latent TGF-b binding proteins. Latent forms are complexes of TGF beta-1, an amino-terminal portion of the TGF-beta precursor, designated TGF-LAP (TGF-latency associated peptide), and a specific binding protein, known as LTBP. TGF beta-1 helps regulates proliferation, differentiation, adhesion, migration in many cell types. Many cells have TGF beta receptors, and the protein positively and negatively regulates many other growth factors. TGF beta-1 is cleaved into a latency-associated peptide and a mature TGF beta-1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGF beta-1 homodimer. The mature peptide may also form heterodimers with other TGF beta family members. The gene for TGF beta-1 is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease and cystic fibrosis.

Specifications

• Accession Number: P01137
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7040
• Name: Human TGF beta-1 (aa 194-277) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CED; cytokine; DPD1; LAP; Latency-associated peptide; prepro-transforming growth factor beta-1; regulatory protein; TGF b; TGF b 1; TGF beta; tgf beta 1; tgf beta1; TGF beta-1; TGF beta-1 protein; TGF β; TGF β 1; TGF β1; Tgfb; TGFB1; TGF-B1; Tgfb-1; TGFbeta; TGF-beta 1; TGF-beta 1 protein; TGFbeta1; TGF-beta1; TGF-beta-1; TGFβ1; Transforming growth factor; transforming growth factor b1; transforming growth factor beta; transforming growth factor beta 1; transforming growth factor beta-1; Transforming growth factor beta-1 proprotein; transforming growth factor beta-1 proprotein; transforming growth factor beta-1; transforming growth factor β1; transforming growth factor, beta 1; transforming growth factor, beta 1 (Camurati-Engelmann disease); transforming growth factor, beta-1; transforming growth factor-beta 1; transforming growth factor-beta I; transforming growth factor-beta-1; transforming growth factor-beta-1 precursor; unnamed protein product
• Common Name: TGF beta-1
• Gene Symbol: Tgfb1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining