missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198017

Invitrogen™ Human TFF3 (aa 19-79) Control Fragment Recombinant Protein

Product Code. 30198017
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198017

Brand: Invitrogen™ RP95294

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57279 (PA5-57279. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Trefoil peptides are protease resistant molecules secreted throughout the gut that play a role in mucosal healing. Trefoil peptides contain three intrachain disulfide bonds, forming the trefoil motif, or P-domain and clustered in human chromosome 21q22.3. Trefoil Factor 3 (TFF3) is one of three trefoil peptides secreted by epithelial cells that line mucus membranes in the large and small intestines and lower respiratory tract. TFF3 is mainly active as a disulfide-linked homodimer and may have a role in promoting cell migration in healing processes. It is involved in the maintenance and repair of the intestinal mucosa.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q07654
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7033
Name Human TFF3 (aa 19-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias hITF; hP1.B; Intestinal trefoil factor; ITF; mITF; P1B; Polypeptide P1.B; rITF; rP1.B; Tff3; TFI; Trefoil factor 3; trefoil factor 3 (intestinal); trefoil factor 3, intestinal
Common Name TFF3
Gene Symbol TFF3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.