Invitrogen™ Human TFAM (aa 171-244) Control Fragment Recombinant Protein

Product Code. 30208189

Brand: Invitrogen™ RP105270

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mitochondrial transcription factor A (TFAM) is a crucial protein encoded by nuclear genes, but it is transported from the cytoplasm to mitochondria where it plays a key role in the maintenance and expression of mitochondrial DNA (mtDNA). It regulates the replication and transcription of mtDNA, ensuring the proper functioning of mitochondrial processes. Structurally, TFAM contains a molecular region known as the LC3 interacting region (LIR) motif, which allows it to bind to autophagy proteins such as LC3. This interaction is essential for the autolysosomal pathway, helping to eliminate leaked mtDNA and limit inflammation. TFAM levels vary across tissues, with notable effects on mitochondrial function; high levels can repress mtDNA expression in certain tissues, such as skeletal muscle, and contribute to deficiencies in oxidative phosphorylation (OXPHOS). Conversely, in other tissues like the heart, increased mtDNA copy number maintains a balanced TFAM-to-mtDNA ratio, preserving OXPHOS capacity. TFAM is integral to the packaging, stability, and replication of the mitochondrial genome, and disruptions in TFAM can have severe effects, including implications in neurodegeneration and other diseases related to mtDNA stress.

Specifications

• Accession Number: Q00059
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7019
• Name: Human TFAM (aa 171-244) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI661103; Hmgts; Mitochondrial transcription factor 1; mitochondrial transcription factor A; MTTF1; mtTFA; TCF6; TCF-6; TCF6L1; TCF6L2; TCF6L3; Testis-specific high mobility group protein; testis-specific HMG-box protein m-tsHMG; TFAM; Transcription factor 6; transcription factor 6-like 1; transcription factor 6-like 2; transcription factor 6-like 2 (mitochondrial transcription factor); transcription factor 6-like 3; transcription factor A, mitochondrial; tsHMG; TS-HMG
• Common Name: TFAM
• Gene Symbol: Tfam
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining