missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202450

Invitrogen™ Human TET3 (aa 1204-1322) Control Fragment Recombinant Protein

Product Code. 30202450
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202450

Brand: Invitrogen™ RP91314

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62255 (PA5-62255. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TET3, a member of the ten-eleven-translocation (TET) family of genes, is a methylcytosine dioxygenase that catalyzes the conversion of methylcytosine to 5-hydroxymethylcytosine and is most abundantly expressed in hematopoietic cells. Unlike the related TET2 protein, mutations in TET3 have not been observed in any myeloid malignancies. TET3 has been shown to be involved in the demethylation of zygotic DNA before the first mitosis and has been suggested to be involved in the epigenetic reprogramming of the zygotic paternal DNA following natural fertilization and may also contribute to somatic cell nuclear reprogramming during animal cloning.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43151
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 200424
Name Human TET3 (aa 1204-1322) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B430006D22Rik; BC037432; D230004J03Rik; hCG_40738; KIAA0401; Methylcytosine dioxygenase TET3; MGC22014; probable methylcytosine dioxygenase TET3; putative methylcytosine dioxygenase; Tet methylcytosine deoxygenase 3 isoform; tet methylcytosine dioxygenase 3; tet oncogene family member 3; Tet3
Common Name TET3
Gene Symbol TET3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLKGGLSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVYSYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGHSGSSGSFEKKPDLH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.