Invitrogen™ Human TESK2 (aa 428-499) Control Fragment Recombinant Protein

Product Code. 30200590

Brand: Invitrogen™ RP107293

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111574 (PA5-111574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TESK2 or testis-specific kinase 2 is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. The kinase domain of TESK2 is structurally similar to the kinase domain of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). TESK2 is predominantly expressed in testis and prostate and plays an important role in spermatogenesis. TESK2 phosphorylates cofilin specifically at Ser-3 and induces formation of actin stress fibers and focal adhesions.

Specifications

• Accession Number: Q96S53
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10420
• Name: Human TESK2 (aa 428-499) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: dual specificity testis-specific protein kinase 2; TESK2; Testicular protein kinase 2; testis-specific kinase 2
• Common Name: TESK2
• Gene Symbol: TESK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining