missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TESK2 (aa 428-499) Control Fragment Recombinant Protein

Product Code. 30200590
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200590

Brand: Invitrogen™ RP107293

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111574 (PA5-111574. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TESK2 or testis-specific kinase 2 is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. The kinase domain of TESK2 is structurally similar to the kinase domain of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). TESK2 is predominantly expressed in testis and prostate and plays an important role in spermatogenesis. TESK2 phosphorylates cofilin specifically at Ser-3 and induces formation of actin stress fibers and focal adhesions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96S53
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10420
Name Human TESK2 (aa 428-499) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dual specificity testis-specific protein kinase 2; TESK2; Testicular protein kinase 2; testis-specific kinase 2
Common Name TESK2
Gene Symbol TESK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FDLDAPGPGTMPLADWQEPLAPPIRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.