Invitrogen™ Human TERT (aa 406-504) Control Fragment Recombinant Protein

Product Code. 30211605

Brand: Invitrogen™ RP106558

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84213 (PA5-84213. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase (TERT) have been identified; the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity.

Specifications

• Accession Number: O14746
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7015
• Name: Human TERT (aa 406-504) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CMM9; DKCA2; DKCB4; EST2; HEST2; hTERT; hTRT; PFBMFT1; RGD:70494}; TCS1; Telomerase catalytic subunit; telomerase reverse transcriptase; telomerase reverse transcriptase beta; telomerase-associated protein 2; TERT; tert {ECO:0000312; TP2; TR; TRT
• Common Name: TERT
• Gene Symbol: TERT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining