missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213307

Invitrogen™ Human TENM1 (aa 32-108) Control Fragment Recombinant Protein

Product Code. 30213307
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213307

Brand: Invitrogen™ RP110036

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144912 (PA5-144912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The teneurin transmembrane protein 1 (TENM1) is a member of a family of four neuronal cell surface proteins homologous to the Drosophila pair-rule gene Ten-m. TENM1 is expressed primarily in the developing central nervous system and may be proteolytically cleaved with the intracellular domain translocating to the nucleus. TENM1 is a direct target of the homeobox transcription factor EMX2, a transcription factor thought to be important for area specification in the developing cortex.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9UKZ4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10178
Name Human TENM1 (aa 32-108) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias IDten-1; odz (odd Oz/ten-m, Drosophila) homolog 3; odz, odd Oz/ten-m homolog 1; odz, odd Oz/ten-m homolog 1(Drosophila); Odz1; Odz2; ODZ3; Protein Odd Oz/ten-m homolog 1; RGD1561678; TCAP-1; TCPA-1; Ten-1; Ten-1 ECD; Ten-1 extracellular domain; Ten-1 intracellular domain; tenascin M1; tenascin-M1; teneurin 1; Teneurin C-terminal-associated peptide; Teneurin transmembrane protein 1; teneurin-1; TENM1; Ten-m1; TNM; TNM1
Common Name TENM1
Gene Symbol TENM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.