Invitrogen™ Human TENM1 (aa 32-108) Control Fragment Recombinant Protein

Product Code. 30213307

Brand: Invitrogen™ RP110036

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144912 (PA5-144912. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The teneurin transmembrane protein 1 (TENM1) is a member of a family of four neuronal cell surface proteins homologous to the Drosophila pair-rule gene Ten-m. TENM1 is expressed primarily in the developing central nervous system and may be proteolytically cleaved with the intracellular domain translocating to the nucleus. TENM1 is a direct target of the homeobox transcription factor EMX2, a transcription factor thought to be important for area specification in the developing cortex.

Specifications

• Accession Number: Q9UKZ4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10178
• Name: Human TENM1 (aa 32-108) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: IDten-1; odz (odd Oz/ten-m, Drosophila) homolog 3; odz, odd Oz/ten-m homolog 1; odz, odd Oz/ten-m homolog 1(Drosophila); Odz1; Odz2; ODZ3; Protein Odd Oz/ten-m homolog 1; RGD1561678; TCAP-1; TCPA-1; Ten-1; Ten-1 ECD; Ten-1 extracellular domain; Ten-1 intracellular domain; tenascin M1; tenascin-M1; teneurin 1; Teneurin C-terminal-associated peptide; Teneurin transmembrane protein 1; teneurin-1; TENM1; Ten-m1; TNM; TNM1
• Common Name: TENM1
• Gene Symbol: TENM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining