Invitrogen™ Human Tenascin R (aa 977-1063) Control Fragment Recombinant Protein

Artikelnummer. 30193635

Marke: Invitrogen™ RP94059

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56275 (PA5-56275. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tenascin-R (TNR) is an extracellular matix protein expressed primarily in the central nervous system. It is a member of the tenascin (TN) gene family, which includes at least 3 genes in mammals: TNC (or hexabrachion; MIM 187380), TNX (TNXB; MIM 600985), and TNR (Erickson, 1993). The genes are expressed in distinct tissues at different times during embryonic development and are present in adult tissues.

Spezifikation

• Accession Number: Q92752
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7143
• Name: Human Tenascin R (aa 977-1063) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: J1NRM; J1-tenascin; janusin; Neural recognition molecule J1-160/180; restrictin; tenascin R; tenascin R (restrictin, janusin); tenascin-R; Tenascin-R (Restrictin janusin J1-160/180); Tenascin-R (Restrictin, janusin, J1-160/180); Tnr; TN-R
• Common Name: Tenascin R
• Gene Symbol: Tnr
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTATMYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining