Invitrogen™ Human TEM5 (aa 158-271) Control Fragment Recombinant Protein

Product Code. 30210030

Brand: Invitrogen™ RP109719

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144689 (PA5-144689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Tumor endothelial markers (TEMs) are significantly up-regulated during angiogenesis and neoangiogensis that are crucial for the growth of solid tumors. TEMs localized on the cell surface and conserved across species are of particular interest for future development of anti-angiogenic therapies. These include TEMs such as TEM1, TEM5, TEM7 and TEM8. TEM5 is a member of the adhesion family of G protein coupled receptors and is localized on the surface of endothelial cells. TEM5 is a seven-pass transmembrane receptor, unlike TEM1, TEM7 and TEM8 which span the membrane once. TEM5 is abundantly expressed in tumor vessels, heart, placenta, ovary, small intestine, and colon. Proteolytically processed soluble TEM5 mediates endothelial cell survival during angiogenesis by linking integrin to glycosaminoglycans.

Specifications

• Accession Number: Q96PE1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25960
• Name: Human TEM5 (aa 158-271) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430414O08Rik; 9530074E10Rik; Adgra2; Adgra3; Adhesion G protein-coupled receptor A2; adhesion G protein-coupled receptor A3; DKFZp434C211; DKFZp434J0911; FLJ14390; G protein-coupled receptor 124; Gpr124; G-protein coupled receptor 124; KIAA1531; LOC100363275; mKIAA1531; Tem5; Tumor endothelial marker 5
• Common Name: TEM5
• Gene Symbol: ADGRA2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALHAQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSAS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining