Invitrogen™ Human TELO2 (aa 361-462) Control Fragment Recombinant Protein

Product Code. 30182349

Brand: Invitrogen™ RP98676

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59583 (PA5-59583. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TELO2 is a protein that functions as an S-phase checkpoint protein in the cell cycle. The protein may also play a role in DNA repair.

Specifications

• Accession Number: Q9Y4R8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9894
• Name: Human TELO2 (aa 361-462) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200003M09Rik; AI415602; CLK2; hCLK2; KIAA0683; mKIAA0683; protein clk-2 homolog; RGD1305553; Tel2; TEL2, telomere maintenance 2, homolog; TEL2, telomere maintenance 2, homolog (S. cerevisiae); Telo2; Telomere length regulation protein TEL2 homolog; telomere maintenance 2; YHFS
• Common Name: TELO2
• Gene Symbol: TELO2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKAVLICLAQLGEPELRDSRDELLASMMAGVKCRLDSSLPPVRRLGMIVAEVVSARIHPEGPPLKFQYEEDELSLELLALASPQPAGDGASEAGTSLVPATA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining