Invitrogen™ Human TECPR2 (aa 1270-1411) Control Fragment Recombinant Protein

Product Code. 30198241

Brand: Invitrogen™ RP88938

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51435 (PA5-51435. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifikationer

• Accession Number: O15040
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9895
• Name: Human TECPR2 (aa 1270-1411) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: KIAA0297; KIAA0329; SPG49; TECPR2; tectonin beta-propeller repeat containing 2; tectonin beta-propeller repeat-containing protein 2; WD repeat-containing protein KIAA0329/KIAA0297
• Common Name: TECPR2
• Gene Symbol: TECPR2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSVHSSPNDQMLWVLDSRWNVHVRTGITEEMPVGTAWEHVPGLQACQLALSTRTVWARCPNGDLARRYGVTDKNPAGDYWKKIPGSVSCFTVTASDELWAVGPPGYLLQRLTKTFSHSHGTQKSSQAAMPHPEDLEDEWEVI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining