Invitrogen™ Human TEC (aa 231-380) Control Fragment Recombinant Protein

Product Code. 30213286

Brand: Invitrogen™ RP95919

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110697 (PA5-110697. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TEC is a non-receptor protein-tyrosine kinase containing a pleckstrin homology domain and is highly expressed in many hematopoietic cell lines. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

Specifications

• Accession Number: P42680
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100124696, 7006
• Name: Human TEC (aa 231-380) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: cytoplasmic tyrosine kinase, Dscr28C related; MGC126760; MGC126762; PSCTK4; TEC; tec protein tyrosine kinase; tyrosine-protein kinase Tec
• Common Name: TEC
• Gene Symbol: Tec
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining