Invitrogen™ Human TEB4 (aa 544-628) Control Fragment Recombinant Protein

Product Code. 30205083

Brand: Invitrogen™ RP105994

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65278 (PA5-65278. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MARCH6 is an E3 ubiquitin ligase that localizes to endoplasmic reticulum membranes.

Specifications

• Accession Number: O60337
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10299
• Name: Human TEB4 (aa 544-628) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3830408G03; 6-Mar; DOA10; doa10 homolog; E3 ubiquitin-protein ligase MARCH6; F830029L24Rik; KIAA0597; MARCH6; MARCH-VI; membrane associated ring finger 6; membrane associated ring-CH-type finger 6; membrane-associated ring finger (C3HC4) 6; membrane-associated ring finger (C3HC4) 6, E3 ubiquitin protein ligase; membrane-associated RING finger protein 6; membrane-associated RING-CH finger protein 6; membrane-associated RING-CH protein VI; mKIAA0597; Protein TEB-4; RING finger protein 176; RING-type E3 ubiquitin transferase MARCH6; RNF176; TEB4
• Common Name: TEB4
• Gene Symbol: MARCHF6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HTRQWLKGLVRAWTVTAGYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining