Invitrogen™ Human TDRP (aa 35-184) Control Fragment Recombinant Protein

Product Code. 30209117

Brand: Invitrogen™ RP89739

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52565 (PA5-52565. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Contributes to normal sperm motility, but not essential for male fertility.

Specifications

• Accession Number: Q86YL5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 157695
• Name: Human TDRP (aa 35-184) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610019F03Rik; C25H8orf42; C8orf42; Inm01; Protein INM01; TDRP; TDRP1; TDRP2; testis development related protein; testis development-related protein
• Common Name: TDRP
• Gene Symbol: TDRP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AQVQGASFRGWKEVTSLFNKDDEQHLLERCKSPKSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEIEGWEPPKLALEDISADPEDTVGGHPSWSGWEDDAKGSTKYTSLASSANSSRWSLRAAGRLVSIRRQSKGHLTDSPEEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining