missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TDE1 (aa 60-96) Control Fragment Recombinant Protein

Product Code. 30182439
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30182439 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30182439 Supplier Invitrogen™ Supplier No. RP99433

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61654 (PA5-61654. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TDE1, tumor differentially expressed protein 1, is a multi-pass membrane protein also known as serine incorporator 3. Also found on the membranes of the Golgi apparatus within cells, TDE1 is highly expressed in neuronal populations but is also found in thymus, kidney, liver and testis. Expression levels of TDE1 in tumors can be as much as tenfold the amount found in normal tissue of the same type. This increased expression implicates TDE1 as being involved in the cellular transformation from normal to malignant tissue. It is believed TDE1 contributes to oncogenesis by partially protecting cells from serum starvation and etoposide-induced apoptosis. The mechanism through which TDE1 protects cells is poorly understood, but may involve aberrant methylation of TDE1 complexes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13530
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10955
Name Human TDE1 (aa 60-96) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA959945; AA960047; Aigp1; AIGP-1; axotomy-induced glyco/Golgi protein 1; Axotomy-induced glycoprotein 1; DIFF33; Membrane protein TMS-1; SBBI99; Serinc3; Serine incorporator 3; TDE; TDE1; Tms1; TMS-1; tumor differentially expressed 1; tumor differentially expressed protein 1
Common Name TDE1
Gene Symbol Serinc3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.