missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TCTN1 (aa 374-456) Control Fragment Recombinant Protein

Product Code. 30181578
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181578

Brand: Invitrogen™ RP97901

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58883 (PA5-58883. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCTN1 is the founding member of the Tectonic protein family, a group of evolutionarily conserved secreted and transmembrane proteins that regulate the Hedgehog (Hh)-mediated patterning of the neural tube. During embryonic development, TCTN1 is expressed in regions that participate in Hh signaling, beginning in the gastrulation stages in the ventral node. Mice expressing mutant TCTN1 die between E13. 5 and E16. 5 and display holoprosencephaly, a defect associated with reduced Hh signaling, indicating the role of TCTN1 as an Hh activator. At later stages in development, TCTN1 is thought to also act as a repressor on the Hh pathway in the anterior and posterior neural tube.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q2MV58
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79600
Name Human TCTN1 (aa 374-456) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias G730031O11Rik; JBTS13; RGD1566266; TCTN1; TECT1; tectonic family member 1; tectonic-1; UNQ9369/PRO34160
Common Name TCTN1
Gene Symbol TCTN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQDCLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.