Invitrogen™ Human TCTEX1D4 Control Fragment Recombinant Protein

Product Code. 30196939

Brand: Invitrogen™ RP101827

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64044 (PA5-64044. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Dyneins are multi-subunit, high molecular weight ATPases that interact with microtubules to generate force by converting the chemical energy of ATP into the mechanical energy of movement. Cytoplasmic or axonemal Dynein is an approximately 12 subunit complex of two heavy chains, two intermediate chains to anchor Dynein to its cargo, four smaller intermediate chains and several light chains. It performs functions necessary for cell survival such as organelle transport and centrosome assembly. TCTEX1 is a cytoplasmic dynein light chain found in a complex with Na+ CP type X (SCN10A). TCTEX1D4, also called TCTEX2 beta, interacts with different members of the TGF-beta receptor family, and when overexpressed, inhibits TGF-beta signaling.

Specifications

• Accession Number: Q5JR98
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 343521
• Name: Human TCTEX1D4 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833401D15Rik; LOC102551208; N22.1; novel Tctex-1 family domain-containing protein; protein N22.1; Tcte x 1 domain containing 4; tcte x 1 domain-containing protein 4; tcte x 1 domain-containing protein 4-like; Tcte x 1d4; Tcte x 2 beta; Tctex-2-beta
• Common Name: TCTEX1D4
• Gene Symbol: TCTEX1D4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRRNSLVGPGAGPGGQRPSLGPVPPLGSRVSFSGLPLAPARWVAPSYRTEPVPGERWEAARAQRAME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining