Invitrogen™ Human TCP1 (aa 129-214) Control Fragment Recombinant Protein

Product Code. 30211577

Brand: Invitrogen™ RP94733

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83181 (PA5-83181. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The T Complex Polypeptide 1 (TCP-1) is approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells, and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. The family of proteins termed chaperonins act to recognize and stabilize polypeptide intermediates during folding, assembly and disassembly, and share many characteristics with Heat Shock Protein 70 (HSP70) including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes the mitochondrial HSP60, Escherichia coli GroEL, the plastid Rubisco-subunit binding protein, and the archaebacterial protein TF55. The TCP-1 sequence shows nearly 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.

Specifications

• Accession Number: P17987
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6950
• Name: Human TCP1 (aa 129-214) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 65 kDa antigen; AI528772; c-cpn; CCT; Cct1; Ccta; CCTalpha; CCT-alpha; chaperonin-containing T-complex alpha subunit TCP1; chaperonin-containing T-complex polypeptide alpha subunit; cytosolic chaperonin containing t-complex polypeptide 1; D6S230E; hypothetical protein; p63; tailless complex polypeptide 1; tailless complex polypeptide 1 A; Tailless complex polypeptide 1 B; t-complex 1; t-complex polypeptide 1; t-complex protein 1; T-complex protein 1 alpha subunit-like protein; T-complex protein 1 subunit alpha; T-complex protein 1 subunit alpha A; T-complex protein 1 subunit alpha B; T-complex protein 1, alpha subunit; Tcp1; Tcp-1; TCP-1-A; TCP-1-alpha; TCP-1-B; Tp63; TRic; Unknown (protein for MGC:133746); YD8142.13; YD8142B0.04; YDR212W
• Common Name: TCP1
• Gene Symbol: TCP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining