missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TCP-1 zeta (aa 28-63) Control Fragment Recombinant Protein

Product Code. 30194178
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194178

Brand: Invitrogen™ RP104391

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61036 (PA5-61036. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein TCP-1 (t complex polypeptide 1) is a subunit of the heterooligomeric complex CCT (chaperonin containing TCP-1) present in the eukaryotic cytosol. The CCT of eukaryotic cytosol is composed of eight different subunit species, TCP-1 alpha, beta, gamma, delta, epsilon, zeta, eta and theta, each encoded by a different gene. Two zeta subunits have been described: TCP-1 zeta (also designated TCP-1 zeta1) and TCP-1 zeta2. TCP-1 subunits are proposed to have independent functions in folding its in vivo substrates, the actins and tubulins. TCP-1 was first identified in the mouse as relevant for tail-less and embryonic lethal phenotypes. Sequences homologous to TCP-1 have been isolated in several other species, and the yeast TCP-1 has been shown to encode a molecular chaperone for Actin and Tubulin. TCP-1 found in mammalian cells and yeast plays an important role in the folding of cytosolic proteins.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P40227
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 908
Name Human TCP-1 zeta (aa 28-63) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias acute morphine dependence related protein 2; acute morphine dependence-related protein 2; amino acid transport defect-complementing; CCT zeta1; CCT- zeta1; CCT- zeta-1; CCT zeta-1; Cct6; Cct6a; Cctz; Cctz1; Cctz-1; CCT-zeta; CCT-zeta-1; chaperonin containing T-complex subunit 6; chaperonin containing TCP-1; chaperonin containing TCP1 subunit 6 A; chaperonin containing Tcp1, subunit 6 A (zeta 1); chaperonin containing Tcp1, subunit 6 A (zeta); chaperonin subunit 6 A (zeta); histidine transp; histidine transport regulator 3; HTR3; MoDP-2; T-complex protein 1 subunit zeta; T-complex protein 1, zeta subunit; TCP 1 zeta; TCP1 zeta; TCP-1- zeta; TCP1- zeta; TCP-1-zeta; Tcp20; TCPZ; TTCP20
Common Name TCP-1 zeta
Gene Symbol CCT6A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.