Invitrogen™ Human TCP-1 theta (aa 143-232) Control Fragment Recombinant Protein

Product Code. 30196713

Brand: Invitrogen™ RP91817

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53830 (PA5-53830. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCP-1 theta is theta subunit of the CCT (chaperonin containing TCP1 complex) chaperonin molecule which is abundant in the eukaryotic cytosol and may be involved in the transport and assembly of the newly synthesized proteins. Molecular chaperones assist in the protein folding upon ATP hydrolysis and TCP-1 theta may play a role in the assembly of the BBsome, a complex that is involved in ciliogenesis regulating transport vesicles to the cilia. Further, TCP-1 theta is also involved in the folding of actin and tubulin. The intact CCT complex is composed of eight polypeptides in a double ring structure. CCT is important within cells in the folding of the VHL tumor suppressor protein.

Specifications

• Accession Number: P50990
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10694
• Name: Human TCP-1 theta (aa 143-232) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI132397; bdav; bette davis; C21orf112; Cct8; Cctq; CCT-theta; Chaperonin containing T-complex polypeptide 1 subunit 8; chaperonin containing TCP1 subunit 8; chaperonin containing TCP1, subunit 8 (theta); chaperonin subunit 8 (theta); D21S246; fa22h09; KIAA0002; PRED71; renal carcinoma antigen NY-REN-15; T-complex protein 1 subunit theta; TCP-1-theta; Tcpq; wu:fa22h09; zgc:56059
• Common Name: TCP-1 theta
• Gene Symbol: CCT8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining