Invitrogen™ Human TCP-1 beta (aa 392-519) Control Fragment Recombinant Protein

Product Code. 30208026

Brand: Invitrogen™ RP96783

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82068 (PA5-82068. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCP-1 beta is a molecular chaperone that is member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). The CCT complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of the TCP-1 beta gene have been observed but not thoroughly characterized. A disease associated with TCP-1 beta protein dysfunction include epididymo-orchitis.

Specifications

• Accession Number: P78371
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10576
• Name: Human TCP-1 beta (aa 392-519) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 99D8.1; AI528772; c-cpn; CCT; Cct1; CCT2; Ccta; CCTB; CCT-beta; chaperonin containing t-complex polypeptide 1, beta subunit; chaperonin containing t-complex polypeptide 1, subunit 2; chaperonin containing TCP1 subunit 2; chaperonin containing Tcp1, subunit 2 (beta); chaperonin subunit 2 (beta); chaperonin-containing T-complex polypeptide beta subunit; epididymis secretory sperm binding protein Li 100 n; HEL-S-100 n; hypothetical protein LOC505313; p63; PRO1633; T-complex protein 1 subunit beta; T-complex protein 1, beta subunit; Tcp-1; TCP-1-beta; Tp63; TRic
• Common Name: TCP-1 beta
• Gene Symbol: CCT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining