Invitrogen™ Human TCFL5 (aa 341-418) Control Fragment Recombinant Protein

Product Code. 30204683

Brand: Invitrogen™ RP101724

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84246 (PA5-84246. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCFL5 is a new bHLH transcription factor that negatively regulates upstream transcription factor-dependent transcription.

Specifications

• Accession Number: Q9UL49
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10732
• Name: Human TCFL5 (aa 341-418) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AV260129; bHLHe82; CHA; Cha transcription factor; E2BP1; E2BP-1; factor in the germline beta; FIG beta; Figlb; HPV-16 E2-binding protein 1; LOW QUALITY PROTEIN: transcription factor-like 5 protein; MGC46135; RGD1305899; SOSF1; TCFL5; transcription factor like 5; transcription factor-like 5 (basic helix-loop-helix); transcription factor-like 5 protein
• Common Name: TCFL5
• Gene Symbol: TCFL5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRNRSRMRQLDTNVERRALGEIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining